Loading...
Statistics
Advertisement

DataLife Engine - Панель ÑƒÐ¿Ñ€Ð°Ð²Ð»ÐµÐ½Ð¸Ñ ...
www.android-plays.com/

Android-plays.com

Advertisement
Conversion Technology Metas Server
Android-plays.com is hosted in Russian Federation . Android-plays.com uses HTTPS protocol. Number of used technologies: 6. First technologies: CSS, Html, Javascript, Number of used javascripts: 3. First javascripts: Jquery.js, Jqueryui.js, Default.js, Number of used analytics tools: 0. Its server type is: nginx-reuseport/1.11.1.

Technologies in use by Android-plays.com

Technology

Number of occurences: 6
  • CSS
  • Html
  • Javascript
  • jQuery
  • jQuery UI
  • Php

Advertisement

Javascripts

Number of occurences: 3
  • jquery.js
  • jqueryui.js
  • default.js

Server Type

  • nginx-reuseport/1.11.1

Powered by

  • PHP/5.6.23

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Android-plays.com

SSL certificate

    • name: /CN=t-cs.ru
    • subject:
      • CN: t-cs.ru
    • hash: dd3f3216
    • issuer:
      • C: US
      • O: Let's Encrypt
      • CN: Let's Encrypt Authority X3
    • version: 2
    • serialNumber: 317414756796866591014260852892231858408352
    • validFrom: 160720011000Z
    • validTo: 161018011000Z
    • validFrom_time_t: 1468977000
    • validTo_time_t: 1476753000
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • basicConstraints: CA:FALSE
      • subjectKeyIdentifier: F3:92:A3:55:7E:1D:61:C4:FF:B2:BD:E3:8F:41:07:18:A8:E3:A6:3F
      • authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
      • authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
      • subjectAltName: DNS:demo642.t-cs.ru, DNS:democase.t-cs.ru, DNS:t-cs.ru, DNS:www.demo642.t-cs.ru, DNS:www.democase.t-cs.ru, DNS:www.t-cs.ru
      • certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/

Meta - Android-plays.com

Number of occurences: 1
  • Name:
    Content: text/html; charset=utf-8

Server / Hosting

  • IP: 87.236.19.12
  • Latitude: 55.74
  • Longitude: 37.61
  • Country: Russian Federation

Rname

  • ns2.beget.com
  • ns1.beget.pro
  • ns2.beget.pro
  • ns1.beget.com
  • mx1.beget.com
  • mx2.beget.com

Target

  • hostmaster.beget.com

HTTP Header Response

HTTP/1.1 302 Found Server: nginx-reuseport/1.11.1 Date: Tue, 30 Aug 2016 02:02:28 GMT Content-Type: text/html Content-Length: 53 X-Powered-By: PHP/5.6.23 Location: /install.php X-Cache: MISS from s_ub9 X-Cache-Lookup: MISS from s_ub9:80 Via: 1.1 s_ub9 (squid/3.5.20) Connection: keep-alive HTTP/1.1 200 OK Server: nginx-reuseport/1.11.1 Date: Tue, 30 Aug 2016 02:02:29 GMT Content-Type: text/html Vary: Accept-Encoding X-Powered-By: PHP/5.6.23 Set-Cookie: PHPSESSID=9b874135b23981d62cd08657139ec681; path=/ Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache X-Cache: MISS from s_ub9 X-Cache-Lookup: MISS from s_ub9:80 Transfer-Encoding: chunked Via: 1.1 s_ub9 (squid/3.5.20) Connection: keep-alive

DNS

host: android-plays.com
  1. class: IN
  2. ttl: 600
  3. type: A
  4. ip: 87.236.19.12
host: android-plays.com
  1. class: IN
  2. ttl: 300
  3. type: NS
  4. target: ns2.beget.com
host: android-plays.com
  1. class: IN
  2. ttl: 300
  3. type: NS
  4. target: ns1.beget.pro
host: android-plays.com
  1. class: IN
  2. ttl: 300
  3. type: NS
  4. target: ns2.beget.pro
host: android-plays.com
  1. class: IN
  2. ttl: 300
  3. type: NS
  4. target: ns1.beget.com
host: android-plays.com
  1. class: IN
  2. ttl: 300
  3. type: SOA
  4. mname: ns1.beget.com
  5. rname: hostmaster.beget.com
  6. serial: 1467313781
  7. refresh: 300
  8. retry: 600
  9. expire: 86400
  10. minimum-ttl: 300
host: android-plays.com
  1. class: IN
  2. ttl: 600
  3. type: MX
  4. pri: 10
  5. target: mx1.beget.com
host: android-plays.com
  1. class: IN
  2. ttl: 600
  3. type: MX
  4. pri: 20
  5. target: mx2.beget.com
host: android-plays.com
  1. class: IN
  2. ttl: 600
  3. type: TXT
  4. txt: v=spf1 redirect=beget.com
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.ndroid-plays.com, www.aondroid-plays.com, www.ondroid-plays.com, www.apndroid-plays.com, www.pndroid-plays.com, www.a9ndroid-plays.com, www.9ndroid-plays.com, www.android-plays.com, www.ndroid-plays.com, www.aindroid-plays.com, www.indroid-plays.com, www.aundroid-plays.com, www.undroid-plays.com, www.adroid-plays.com, www.anndroid-plays.com, www.android-plays.com, www.anhdroid-plays.com, www.ahdroid-plays.com, www.anjdroid-plays.com, www.ajdroid-plays.com, www.ankdroid-plays.com, www.akdroid-plays.com, www.anldroid-plays.com, www.aldroid-plays.com, www.an droid-plays.com, www.a droid-plays.com, www.anroid-plays.com, www.andtroid-plays.com, www.antroid-plays.com, www.andgroid-plays.com, www.angroid-plays.com, www.andbroid-plays.com, www.anbroid-plays.com, www.andxroid-plays.com, www.anxroid-plays.com, www.andsroid-plays.com, www.ansroid-plays.com, www.andfroid-plays.com, www.anfroid-plays.com, www.andvroid-plays.com, www.anvroid-plays.com, www.andyroid-plays.com, www.anyroid-plays.com, www.andzroid-plays.com, www.anzroid-plays.com, www.andaroid-plays.com, www.anaroid-plays.com, www.anderoid-plays.com, www.aneroid-plays.com, www.andrroid-plays.com, www.anrroid-plays.com, www.andoid-plays.com, www.andrioid-plays.com, www.andioid-plays.com, www.androoid-plays.com, www.andooid-plays.com, www.andrloid-plays.com, www.andloid-plays.com, www.andrloid-plays.com, www.andloid-plays.com, www.andr.oid-plays.com, www.and.oid-plays.com, www.andrid-plays.com, www.androbid-plays.com, www.andrbid-plays.com, www.androhid-plays.com, www.andrhid-plays.com, www.androgid-plays.com, www.andrgid-plays.com, www.androjid-plays.com, www.andrjid-plays.com, www.andromid-plays.com, www.andrmid-plays.com, www.andro id-plays.com, www.andr id-plays.com, www.androvid-plays.com, www.andrvid-plays.com, www.androd-plays.com, www.androird-plays.com, www.andrord-plays.com, www.androifd-plays.com, www.androfd-plays.com, www.androivd-plays.com, www.androvd-plays.com, www.androikd-plays.com, www.androkd-plays.com, www.androi,d-plays.com, www.andro,d-plays.com, www.androibd-plays.com, www.androbd-plays.com, www.androigd-plays.com, www.androgd-plays.com, www.androitd-plays.com, www.androtd-plays.com, www.androiyd-plays.com, www.androyd-plays.com, www.androiud-plays.com, www.androud-plays.com, www.androijd-plays.com, www.androjd-plays.com, www.androimd-plays.com, www.andromd-plays.com, www.androind-plays.com, www.andrond-plays.com, www.androi-plays.com, www.androidt-plays.com, www.androit-plays.com, www.androidg-plays.com, www.androig-plays.com, www.androidb-plays.com, www.androib-plays.com, www.androidx-plays.com, www.androix-plays.com, www.androids-plays.com, www.androis-plays.com, www.androidf-plays.com, www.androif-plays.com, www.androidv-plays.com, www.androiv-plays.com, www.androidy-plays.com, www.androiy-plays.com, www.androidz-plays.com, www.androiz-plays.com, www.androida-plays.com, www.androia-plays.com, www.androide-plays.com, www.androie-plays.com, www.androidr-plays.com, www.androir-plays.com, www.androidplays.com, www.android-tplays.com, www.androidtplays.com, www.android-gplays.com, www.androidgplays.com, www.android-hplays.com, www.androidhplays.com, www.android-uplays.com, www.androiduplays.com, www.android-jplays.com, www.androidjplays.com, www.android-xplays.com, www.androidxplays.com, www.android-splays.com, www.androidsplays.com, www.android-aplays.com, www.androidaplays.com, www.android-plays.com, www.androidplays.com, www.android- plays.com, www.android plays.com, www.android-lays.com, www.android-pilays.com, www.android-ilays.com, www.android-pklays.com, www.android-klays.com, www.android-pulays.com, www.android-ulays.com, www.android-pjlays.com, www.android-jlays.com, www.android-pllays.com, www.android-llays.com,

Other websites we recently analyzed

  1. Softshell jassen voor dames, heren en kinderen | SoftshellWebshop.nl
    Softshell jassen voor dames, heren en kinderen. Ontdek de nieuwe zomercollectie 2016! ✓ Ook grote maten. Koop uw softshell jack online: gratis verzending.
    Netherlands - 5.61.248.217
    Server software: Apache/2
    Technology: CSS, Cufon, Html, Javascript, jQuery Cycle, Zopim Live Chat, Clicky Web Analytics, Google Analytics, Magento
    Number of Javascript: 21
    Number of meta tags: 4
  2. plantspearlsparanoia | Growing Seedlings & Other Thoughts
    Provo (United States) - 173.254.14.138
    Server software: nginx/1.8.1
    Technology: CSS, Html, Html5, Javascript, Php, Pingback, Wordpress
    Number of Javascript: 1
    Number of meta tags: 2
  3. designertobuyers.com
    Scottsdale (United States) - 50.63.202.44
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  4. SeaMODE Speed Lab
    Gloucester (United Kingdom) - 213.171.218.7
    G Analytics ID: UA-79673652-1
    Server software: nginx
    Technology: CSS, Html, Javascript, Google Analytics
    Number of meta tags: 1
  5. HostingDiscounter De goedkoopste webhoster van nederland
    HostingDiscounter De goedkoopste webhoster van Nederland - Goedkope domeinnaam registratie, Domein hosting met veel diskspace op uw shared of dedicated server
    Netherlands - 77.95.252.42
    Server software: Apache/2.2.22 (Ubuntu)
    Technology: Html, Javascript
    Number of Javascript: 1
    Number of meta tags: 5
  6. Home | Hoveniersbedrijf Slaats | Hovenier, Deurne, Fred Slaats
    Hoveniersbedrijf uit Neerkant bij Deurne, werkzaam in de gehele regio van Noord-Brabant en Limburg. Onze specialiteit is onderhoud en snoeiwerk.
    Netherlands - 149.210.237.177
    Server software: Apache
    Technology: AJAX Libraries API, CSS, Html, Javascript, Add This
    Number of Javascript: 2
    Number of meta tags: 2
  7. Welcome to Gehlin.Com!
    Sweden - 213.180.93.13
    Server software: Apache/2.2.22 (Ubuntu)
    Technology: CSS, Html
    Number of meta tags: 1
  8. tampacriminaldefenselawyer.net
    Wayne (United States) - 216.250.120.114
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  9. 267286.com
    China - 203.195.130.175
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Html5, Iframe, Javascript
    Number of meta tags: 1
  10. Exotic Beads Manufacturer Penang, Georgetown, Ethnic Beads Supplier Malaysia ~ Guo Qiang Sdn Bhd (beadsZONE)
    Guo Qiang Sdn Bhd (beadsZONE) is the largest manufacturer and supplier of ethnic & exotic beads accessories and jewellery in Penang, Malaysia.
    Malaysia - 119.110.102.139
    G Analytics ID: UA-37858188-33
    Server software: Apache
    Technology: CSS, Font Awesome, Html, Javascript, jQuery UI, Php, Google Analytics, Facebook Box
    Number of Javascript: 6
    Number of meta tags: 9

Check Other Websites